PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G045800.1
Common NamePHAVU_003G045800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 296aa    MW: 33502.3 Da    PI: 9.2447
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G045800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding643e-201461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +grWT+eEd++l+d+v+++G ++W++++++ g+ R++k+c++rw +yl
  Phvul.003G045800.1 14 KGRWTPEEDKKLLDYVEKHGHRNWRLVPAKAGLERCGKSCRLRWINYL 61
                        79********************************************97 PP

2Myb_DNA-binding491.4e-1567110146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+++teEd  +++++ +lG++ W+ Ia++++  Rt++++k++w +
  Phvul.003G045800.1  67 RGNFSTEEDHTIIKLHVLLGNK-WSIIAAHLP-QRTDNEIKNYWKT 110
                         89********************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.533965IPR017930Myb domain
SuperFamilySSF466892.72E-3111108IPR009057Homeodomain-like
SMARTSM007176.6E-161363IPR001005SANT/Myb domain
PfamPF002492.0E-181461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-261568IPR009057Homeodomain-like
CDDcd001671.28E-121661No hitNo description
SMARTSM007171.4E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129419.34866116IPR017930Myb domain
PfamPF002495.5E-1467110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2469117IPR009057Homeodomain-like
CDDcd001675.20E-869112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGRKACCEKL GLKKGRWTPE EDKKLLDYVE KHGHRNWRLV PAKAGLERCG KSCRLRWINY  60
LKPDIKRGNF STEEDHTIIK LHVLLGNKWS IIAAHLPQRT DNEIKNYWKT NIKKRLIRMS  120
LDPITITHKT IKQNTFEGCG DGQDQSKDTI NITHVAQWER ARFEAEARGS MLQVGSGSSN  180
LSGLILSKIP TQPCLSSHSV STEHKRVHNM YALVLTTNHD FRSSVSTLSI PKLPAVSNIP  240
QITNTESLLT YKADNNVMEG CVSNLQDDDI MLAVEAFRTA RSESIEELFN EFTSM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-148AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153558.10.0hypothetical protein PHAVU_003G045800g
TrEMBLV7C5T60.0V7C5T6_PHAVU; Uncharacterized protein
STRINGGLYMA02G12242.11e-157(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13536826
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-76myb domain protein 16